PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2197640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 580aa    MW: 65170.6 Da    PI: 4.9492
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2197640.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.7e-52241501127
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lp GfrF+Ptdeel+++yL+ k++g+  ++  vi+e+d++k+ePwdLp  + v++++ ew+fF+++d+ky++g+r nrat++gyWkatgkd+++
  Lj2g3v2197640.1  24 LPLGFRFRPTDEELIDYYLRSKINGHGDDV-WVIREIDVCKWEPWDLPdlSVVRNKDPEWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRKI 116
                      699************************999.89**************96447777888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      +s +++l+g+kktLvfy grapkg++t+Wvmheyr
  Lj2g3v2197640.1 117 KS-GSTLIGMKKTLVFYAGRAPKGKRTHWVMHEYR 150
                      **.99*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-6119174IPR003441NAC domain
PROSITE profilePS5100555.96624174IPR003441NAC domain
PfamPF023652.4E-2725150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0071470Biological Processcellular response to osmotic stress
GO:1900426Biological Processpositive regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MGAVDFCPPP RKVEEVAVLS LNKLPLGFRF RPTDEELIDY YLRSKINGHG DDVWVIREID  60
VCKWEPWDLP DLSVVRNKDP EWFFFCPQDR KYPNGHRLNR ATSHGYWKAT GKDRKIKSGS  120
TLIGMKKTLV FYAGRAPKGK RTHWVMHEYR PTLKELDGTN PGQNPYVLCR LFKKNDESLE  180
GSNEEVEQIA STPTTASFSP EEIQSDPSLV PVSSSLATED DKHLPVIPEQ SEEAISNIIN  240
PVDCHSDGGD AHDAKIQIIE PPAQEDQPLN FDIFYDPNPT FQQLDDKLFS PVHAHFPQEF  300
YYQANNQSDL QYGTNETNIP DFFNSVNWDE FSHEDSTLFN LKDNGSCSDS DVEMANLTLL  360
QAIDAAYPME AIEQRSNAGL FQNNPQMAFS TNVGLDQVTC AVNYNEQSRS FDTVVHGDTG  420
IRIRTRQGRN DQPDMNPTLP SQGIAPRRIR LGRLVMHSHG SDETAKDGSG APPQDHNSKT  480
IIAGEKEASE NHAADESAAV DEPEKTSSES ADSRKICQQP IAKPILGWKD LLLGRRVRYT  540
SKVSSNRAMW SSVLAVSAFI LVSVVLLVSV WGYLRFYTAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-44131786169NAC domain-containing protein 19
4dul_A5e-44131786169NAC domain-containing protein 19
1ut7_B5e-44131786169NO APICAL MERISTEM PROTEIN
1ut7_A5e-44131786169NO APICAL MERISTEM PROTEIN
1ut4_B5e-44131786169NO APICAL MERISTEM PROTEIN
1ut4_A5e-44131786169NO APICAL MERISTEM PROTEIN
3swp_D5e-44131789172NAC domain-containing protein 19
3swp_C5e-44131789172NAC domain-containing protein 19
3swp_B5e-44131789172NAC domain-containing protein 19
3swp_A5e-44131789172NAC domain-containing protein 19
3swm_D5e-44131789172NAC domain-containing protein 19
3swm_C5e-44131789172NAC domain-containing protein 19
3swm_B5e-44131789172NAC domain-containing protein 19
3swm_A5e-44131789172NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.103470.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00108PBMTransfer from AT4G35580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006596412.10.0PREDICTED: protein NTM1-like 9
TrEMBLA0A0R4J5A60.0A0A0R4J5A6_SOYBN; Uncharacterized protein
STRINGGLYMA14G36840.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.33e-94NAC transcription factor-like 9